{"product_id":"proteintech-14859-1-ap","title":"Proteintech, 14859-1-AP, PSMB8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMB8 (14859-1-AP) by Proteintech is a Polyclonal antibody targeting PSMB8 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n14859-1-AP targets PSMB8 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse kidney tissue,  human kidney tissue\nPositive IP detected in: Raji cells\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMB8(Proteasome subunit beta type-8) is also named as LMP7, PSMB5i, RING10, Y2 and belongs to the peptidase T1B family. The gene encodes the chymotrypsin-like catalytic subunit of the immunoproteasome(PMID: 19525961). PSMB8 has a role in controlling pathogenic immune responses and may be a target in autoimmune disorders. Its prosequence is not essential for incorporation of PSMB8 into the maturing proteasome, but it increased the efficiency of PSMB8 incorporation and proteasome maturation(PMID: 10926487). The pro-PSMB8 is a 276aa protein with the molecular mass of 30 kDa, and the mature form is about 23kDa due to the 72aa propeptide cleaved. Defects in PSMB8 are the cause of Nakajo syndrome (NKJO).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6660 Product name: Recombinant human PSMB8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-272 aa of BC001114 Sequence: MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ Predict reactive species\nFull Name: proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7)\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC001114\nGene Symbol: PSMB8\nGene ID (NCBI): 5696\nRRID: AB_2268923\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P28062\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868894711977,"sku":"14859-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14859-1-ap","provider":"Iright","version":"1.0","type":"link"}