{"product_id":"proteintech-14893-1-ap","title":"Proteintech, 14893-1-AP, ATP5D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nATP5D Polyclonal Antibody for WB, IHC, ELISA\n14893-1-AP targets ATP5D in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, NIH\/3T3 cells,  HeLa cells,  HepG2 cells\nPositive IHC detected in: human liver cancer tissue, human lung cancer tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe mitochondrial F1Fo-ATP synthase complex uses energy derived from a proton gradient to synthesize ATP. The ATP5D gene encodes the delta subunit of the mitochondrial ATP synthase F1 complex and belongs to the ATPase epsilon chain family. This gene encode the full length protein of 17 kDa with a transit peptide of 22 amino acid.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6682 Product name: Recombinant human ATP5D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-168 aa of BC002389 Sequence: MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE Predict reactive species\nFull Name: ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 15-17 kDa\nGenBank Accession Number: BC002389\nGene Symbol: ATP5D\nGene ID (NCBI): 513\nRRID: AB_2274510\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30049\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868938883241,"sku":"14893-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14893-1-ap","provider":"Iright","version":"1.0","type":"link"}