{"product_id":"proteintech-14984-1-ap","title":"Proteintech, 14984-1-AP, MCTS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MCTS1 (14984-1-AP) by Proteintech is a Polyclonal antibody targeting MCTS1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14984-1-AP targets MCTS1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HeLa cells,  mouse bladder tissue,  K-562 cells,  MOLT-4 cells,  Raji cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human ovarian  cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMCTS1 is an anti-oncogene that plays a role in cell cycle regulation. It can reduce cell doubling time and anchor-dependent growth. The G1 transition time and the duration of the G1 \/ S transition are shortened. It can also promote the release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits (PMID: 10440924).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6968 Product name: Recombinant human MCTS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC001013 Sequence: MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK Predict reactive species\nFull Name: malignant T cell amplified sequence 1\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 18-21 kDa\nGenBank Accession Number: BC001013\nGene Symbol: MCTS1\nGene ID (NCBI): 28985\nRRID: AB_2878096\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9ULC4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869708013737,"sku":"14984-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14984-1-ap","provider":"Iright","version":"1.0","type":"link"}