{"product_id":"proteintech-14986-1-ap","title":"Proteintech, 14986-1-AP, MGLL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MGLL (14986-1-AP) by Proteintech is a Polyclonal antibody targeting MGLL in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14986-1-AP targets MGLL in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, L02 cells,  SMMC-7721 cells\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human liver tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:300-1:600\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMGLL (monoglyceride lipase) is also named as MAGL, HU-K5 and belongs to the monoacylglycerol lipase family. It converts monoacylglycerides to free fatty acids and glycerol and functions together with hormone-sensitive lipase (HSL) in the mobilization of fatty acids from the triglyceride stores of adipocytes. MGL protein is ubiquitously expressed in kidney, spleen, heart, liver, stomach, brain, lung, adrenal gland, adipose tissue and in brain,there are two bands of 33 kDa and 35 kDa can be detected. The single protein species expressed in muscle is larger (around 40 kDa) (PMID:11470505). This protein can exsit as a homodimer (PMID:19957260).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6970 Product name: Recombinant human MGLL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-313 aa of BC000551 Sequence: METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP Predict reactive species\nFull Name: monoglyceride lipase\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC000551\nGene Symbol: MGLL\nGene ID (NCBI): 11343\nRRID: AB_2143189\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99685\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868902936745,"sku":"14986-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14986-1-ap","provider":"Iright","version":"1.0","type":"link"}