{"product_id":"proteintech-15010-1-ap","title":"Proteintech, 15010-1-AP, SKP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SKP2 (15010-1-AP) by Proteintech is a Polyclonal antibody targeting SKP2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n15010-1-AP targets SKP2 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human lung cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSKP2(S-phase kinase-associated protein 2) is also named as FBXL1 and belongs to the F-box family. It regulates cellular proliferation by targeting several cell cycle-regulated proteins for ubiquitination and degradation, including cyclin-dependent kinase inhibitor CDKN1B(PMID:22200179). The acetylation of SKP2 in the nuclear localization signal (NLS) can promote its cytoplasmic retention, and cytoplasmic SKP2 enhances cellular migration through ubiquitination and destruction of CDH. This protein has 3 isoforms produced by alternative splicing (PMID:26497688, PMID:16902410).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6826 Product name: Recombinant human SKP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-344 aa of BC001441 Sequence: MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSR Predict reactive species\nFull Name: S-phase kinase-associated protein 2 (p45)\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 46-48 kDa\nGenBank Accession Number: BC001441\nGene Symbol: SKP2\nGene ID (NCBI): 6502\nRRID: AB_2187647\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13309\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868837695657,"sku":"15010-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15010-1-ap","provider":"Iright","version":"1.0","type":"link"}