{"product_id":"proteintech-15017-1-ap","title":"Proteintech, 15017-1-AP, IFT27 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IFT27 (15017-1-AP) by Proteintech is a Polyclonal antibody targeting IFT27 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n15017-1-AP targets IFT27 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human RPE cells\nPositive IHC detected in: human brain tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: hTERT-RPE1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRABL4, alo named as IFT27, is a GTP-binding protein that is a core component of the intraflagellar transport complex B. It plays a role in the cargo loading of the retrograde transport machinery.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6967 Product name: Recombinant human RABL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-186 aa of BC000566 Sequence: MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA Predict reactive species\nFull Name: RAB, member of RAS oncogene family-like 4\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC000566\nGene Symbol: RABL4\/IFT27\nGene ID (NCBI): 11020\nRRID: AB_2878100\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BW83\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869466448041,"sku":"15017-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15017-1-ap","provider":"Iright","version":"1.0","type":"link"}