{"product_id":"proteintech-15039-1-ap","title":"Proteintech, 15039-1-AP, CMTM8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CMTM8 (15039-1-AP) by Proteintech is a Polyclonal antibody targeting CMTM8 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n15039-1-AP targets CMTM8 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse bladder tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human liver tissue,  human pancreas tissue,  human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCMTM8, also known as CKLFSF8, is a member of the chemokine-like factor superfamily (CKLFSF). Proteins of this family share similarity with both the chemokine and the transmembrane 4 superfamilies. CMTM8 is an attenuator of EGF-induced signaling (PMID: 16263120). Overexpression of CMTM8 accelerates ligand-induced clearance of EGFR from the cell surface and induces apoptosis via caspase-dependent and -independent pathways (PMID: 17149703). An alternative splice form of CMTM8, CMTM8-v2, arises from a deletion of exon 2. CMTM8-v2 maintains the ability to induce apoptosis (PMID: 17681841).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6776 Product name: Recombinant human CMTM8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-173 aa of BC041390 Sequence: MEEPQRARSHTVTTTASSFAENFSTSSSSFAYDREFLRTLHGFLIVAEIVLGLLVWTLIAGTEYFRVPAFGWVMFVAVSYWVLTVFFLIIYITMTYTRIPQVPWTTVGLCFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGNTYFSFIAWRSRTIQ Predict reactive species\nFull Name: CKLF-like MARVEL transmembrane domain containing 8\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 25-28 kDa\nGenBank Accession Number: BC041390\nGene Symbol: CMTM8\nGene ID (NCBI): 152189\nRRID: AB_10949191\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IZV2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868995637417,"sku":"15039-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15039-1-ap","provider":"Iright","version":"1.0","type":"link"}