{"product_id":"proteintech-15057-1-ap","title":"Proteintech, 15057-1-AP, TPPP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TPPP3 (15057-1-AP) by Proteintech is a Polyclonal antibody targeting TPPP3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15057-1-AP targets TPPP3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells,  HEK-293 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTPPP3 (tubulin polymerization promoting protein 3), also named as TPPP\/p20, is a new member of the TPPP family which binds tubulin and induces tubulin polymerization and microtubule bundling.TPPP3 has been shown to play an important role in cell proliferation and may be implicated in tumorigenesis and metastasis (19633818). TPPP3 was also identified as specific marker for the connective tissues that envelope tendons due to its distinct expression in the developing tendon sheath (19235716). This antibody detects the 19-20 kDa TPPP3 in HeLa and PC-3 cells. The non-specific bands between 40 and 60 kDa were also occasionally observed.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7040 Product name: Recombinant human TPPP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-176 aa of BC000691 Sequence: MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK Predict reactive species\nFull Name: tubulin polymerization-promoting protein family member 3\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 19-20 kDa\nGenBank Accession Number: BC000691\nGene Symbol: TPPP3\nGene ID (NCBI): 51673\nRRID: AB_2878105\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BW30\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869388427433,"sku":"15057-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15057-1-ap","provider":"Iright","version":"1.0","type":"link"}