{"product_id":"proteintech-15084-1-ap","title":"Proteintech, 15084-1-AP, SNRPG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNRPG (15084-1-AP) by Proteintech is a Polyclonal antibody targeting SNRPG in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15084-1-AP targets SNRPG in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse lung tissue,  rat lung tissue\nPositive IHC detected in: human breast cancer tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7163 Product name: Recombinant human SNRPG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC000070 Sequence: MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV Predict reactive species\nFull Name: small nuclear ribonucleoprotein polypeptide G\nCalculated Molecular Weight: 8 kDa\nObserved Molecular Weight: 9 kDa\nGenBank Accession Number: BC000070\nGene Symbol: SNRPG\nGene ID (NCBI): 6637\nRRID: AB_2191789\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62308\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869768863913,"sku":"15084-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15084-1-ap","provider":"Iright","version":"1.0","type":"link"}