{"product_id":"proteintech-15106-1-ap","title":"Proteintech, 15106-1-AP, PCSK4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCSK4 (15106-1-AP) by Proteintech is a Polyclonal antibody targeting PCSK4 in WB, IHC, ELISA applications with reactivity to human samples\n15106-1-AP targets PCSK4 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue,  human placenta tissue\nPositive IHC detected in: human placenta tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProprotein convertase subtilysin\/Kexin Type4 (PCSK4) is a protein convertase enzymes in spermatozoa acrosome membrane, it has an important role in the acrosome reaction through endoproteolytic process that converts the precursor proteins into bioactive protein as a necessary substance to penetrate on the zona pellucida (PMID: 16040806 ). The molecular mass of pro-PCSK4 is 72kDa, and mature PCSK4 is 54 kDa (PMID: 16040806, 19109312).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4007 Product name: Recombinant human PCSK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-242 aa of BC036354 Sequence: MGTRSTLVAIRPLDVSTEGYNNWVFMSTHFWDENPQGVWTLGLENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGSPRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAACPHHRCPASAMVLSLLAVTLGGPVLCGMSMDLPLYAWLSRARATPTKPQVWLPAGT Predict reactive species\nFull Name: proprotein convertase subtilisin\/kexin type 4\nCalculated Molecular Weight: 83 kDa\nObserved Molecular Weight: 54 kDa\nGenBank Accession Number: BC036354\nGene Symbol: PCSK4\nGene ID (NCBI): 54760\nRRID: AB_10644152\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UW60\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887754039465,"sku":"15106-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15106-1-ap","provider":"Iright","version":"1.0","type":"link"}