{"product_id":"proteintech-15114-1-ap","title":"Proteintech, 15114-1-AP, FKBP1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FKBP1B (15114-1-AP) by Proteintech is a Polyclonal antibody targeting FKBP1B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15114-1-AP targets FKBP1B in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-937 cells, mouse brain tissue,  mouse heart tissue,  Jurkat cells\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7153 Product name: Recombinant human FKBP1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC002614 Sequence: MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC Predict reactive species\nFull Name: FK506 binding protein 1B, 12.6 kDa\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC002614\nGene Symbol: FKBP1B\nGene ID (NCBI): 2281\nRRID: AB_11182817\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P68106\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869684125865,"sku":"15114-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15114-1-ap","provider":"Iright","version":"1.0","type":"link"}