{"product_id":"proteintech-15122-1-ap","title":"Proteintech, 15122-1-AP, SIRT5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SIRT5 (15122-1-AP) by Proteintech is a Polyclonal antibody targeting SIRT5 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15122-1-AP targets SIRT5 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, RAW 264.7 cells,  mouse heart tissue,  mouse liver tissue,  rat heart tissue,  rat liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSIRT5, a member fo sirtuin family that is a mitochondrial matrix NAD(+)-dependent deacetylase and mono-ADP-ribosyltransferases. Sirtuins play important role in various cellular processed, such as aging, gene silencing and metabolism. SIRT5 mainly locates in cytoplasm. It is an efficient protein lysine desuccinylase and demalonylase. During prolonged fasting, it can activate CPS1, the committed and regulated enzyme of the urea cycle, and contribute to the regulation of blood ammonia levels.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7195 Product name: Recombinant human SIRT5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-310 aa of BC000126 Sequence: MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS Predict reactive species\nFull Name: sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae)\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC000126\nGene Symbol: SIRT5\nGene ID (NCBI): 23408\nRRID: AB_2188778\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NXA8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887957037225,"sku":"15122-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15122-1-ap","provider":"Iright","version":"1.0","type":"link"}