{"product_id":"proteintech-15186-1-ap","title":"Proteintech, 15186-1-AP, PRL3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRL3 (15186-1-AP) by Proteintech is a Polyclonal antibody targeting PRL3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15186-1-AP targets PRL3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, rat heart tissue\nPositive IHC detected in: human colon cancer tissue, human oesophagus cancer tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPhosphatase of regenerating liver-3 (PRL-3; also known as PTP4A3), encodes a 22-kDa protein that represents a novel class of a superfamily of protein tyrosine phosphatases (PTPs) that are ubiquitously expressed in various tumors. PRL3 was associated with primary tumor growth, tumor reoccurrence, and therapy resistance in many human cancers. This protein was also suggested as a marker to predict the relapse of gastric cancer and invasive breast cancer. (PMID: 22469786, PMID: 30157875)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7249 Product name: Recombinant human PRL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-148 aa of BC003105 Sequence: MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM Predict reactive species\nFull Name: protein tyrosine phosphatase type IVA, member 3\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 20-28 kDa\nGenBank Accession Number: BC003105\nGene Symbol: PTP4A3\nGene ID (NCBI): 11156\nRRID: AB_2878115\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75365\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869424701609,"sku":"15186-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15186-1-ap","provider":"Iright","version":"1.0","type":"link"}