{"product_id":"proteintech-15191-1-ap","title":"Proteintech, 15191-1-AP, COL4A3BP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COL4A3BP (15191-1-AP) by Proteintech is a Polyclonal antibody targeting COL4A3BP in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15191-1-AP targets COL4A3BP in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, HEK-293 cells,  human pancreas tissue,  mouse kidney tissue,  mouse pancreas tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human pancreas tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOL4A3BP(Collagen type IV alpha-3-binding protein) is also named as CERT, STARD11. CERT extracts ceramide from the ER and carries it to the Golgi apparatus in a non-vesicular manner and that a particularly efficient cycle of CERT movement for trafficking of ceramide may proceed at membrane contact sites between the ER and the Golgi apparatus(PMID:17314061). This protein has 3 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7277 Product name: Recombinant human COL4A3BP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 372-598 aa of BC000102 Sequence: EEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF Predict reactive species\nFull Name: collagen, type IV, alpha 3 (Goodpasture antigen) binding protein\nCalculated Molecular Weight: 71 kDa\nObserved Molecular Weight: 80-89 kDa\nGenBank Accession Number: BC000102\nGene Symbol: COL4A3BP\nGene ID (NCBI): 10087\nRRID: AB_2082664\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5P4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868932755625,"sku":"15191-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15191-1-ap","provider":"Iright","version":"1.0","type":"link"}