{"product_id":"proteintech-15196-1-ap","title":"Proteintech, 15196-1-AP, MED10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MED10 (15196-1-AP) by Proteintech is a Polyclonal antibody targeting MED10 in WB, ELISA applications with reactivity to human, mouse, rat samples\n15196-1-AP targets MED10 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMED10, also named as L6, TRG17, or TRG20, is a 135 amino acid protein, which belongs to the Mediator complex subunit 10 family. MED10 localizes in the nucleus and as a component of the Mediator complex, a coactivator is involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Multiprotein mediator complex acting as a coactivator is required for activation of RNA polymerase II transcription by DNA bound transcription factors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7336 Product name: Recombinant human MED10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC003353 Sequence: MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS Predict reactive species\nFull Name: mediator complex subunit 10\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC003353\nGene Symbol: MED10\nGene ID (NCBI): 84246\nRRID: AB_2878117\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BTT4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869708243113,"sku":"15196-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15196-1-ap","provider":"Iright","version":"1.0","type":"link"}