{"product_id":"proteintech-15204-1-ap","title":"Proteintech, 15204-1-AP, CHOP\/GADD153 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHOP\/GADD153 (15204-1-AP) by Proteintech is a Polyclonal antibody targeting CHOP\/GADD153 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n15204-1-AP targets CHOP\/GADD153 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Tunicamycin treated HeLa cells, MCF-7 cells,  HeLa cells,  K-562 cells,  RAW 264.7 cells\nPositive IP detected in: C6 cells\nPositive IHC detected in: human colon cancer tissue, human breast cancer tissue,  human thyroid cancer tissue,  human cervical cancer tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Tunicamycin treated HeLa cells\nPositive FC (Intra) detected in: Tunicamycin treated HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHOP, also known as GADD153 or DDIT3, is a highly conserved gene in both the structural and regulatory regions. Imposed by unfolded and misfolded proteins, CHOP is significantly induced by ER stress. CHOP is considered a proapoptotic marker of ER stress dependent cell death. CHOP acts as a dominant-negative inhibitor of the transcription factor C\/EBP and LAP. It may play an important role in the malignant transformation of nevus to melanoma. The calculated molecular weight of CHOP is 19 kDa, but the protein migrates on an SDS-PAGE gel with an observed molecular mass of 29 kDa (PMID: 1547942).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, bovine, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7354 Product name: Recombinant human CHOP; GADD153 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC003637 Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA Predict reactive species\nFull Name: DNA-damage-inducible transcript 3\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC003637\nGene Symbol: CHOP\nGene ID (NCBI): 1649\nRRID: AB_2292610\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35638\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868818460841,"sku":"15204-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15204-1-ap","provider":"Iright","version":"1.0","type":"link"}