{"product_id":"proteintech-15207-1-ap","title":"Proteintech, 15207-1-AP, CHAC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHAC1 (15207-1-AP) by Proteintech is a Polyclonal antibody targeting CHAC1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, hamster samples\n15207-1-AP targets CHAC1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, hamster samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  CHO cells,  U-251 cells,  C6 cells,  RAW 264.7 cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHAC1(Cation transport regulator-like protein 1) was identified in a co-regulated group of genes enriched for components of the ATF4 (activating transcription factor 4) arm of the unfolded protein response pathway. CHAC1 is a proapoptotic ER stress protein downstream of the pancreatic EIF2α kinase-ATF4 pathway that appears to be important for human physiology and disease(PMID: 19109178). In addition, the study found that high CHAC1 expression is associated with a bad prognosis hinting that CHAC1 may have a possible prognostic significance in breast cancer(PMID: 35930144). The predicted molecular weight of CHAC1 is 24 kDa, and the molecular weight detected by Proteintech is 38 kDa (PMID: 39368995).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, hamster\nCited Reactivity: human, mouse, rat, chicken, yeast\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7360 Product name: Recombinant human CHAC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-222 aa of BC001847 Sequence: MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV Predict reactive species\nFull Name: ChaC, cation transport regulator homolog 1 (E. coli)\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC001847\nGene Symbol: CHAC1\nGene ID (NCBI): 79094\nRRID: AB_2878118\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BUX1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868849524905,"sku":"15207-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15207-1-ap","provider":"Iright","version":"1.0","type":"link"}