{"product_id":"proteintech-15217-1-ap","title":"Proteintech, 15217-1-AP, RPB5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RPB5 (15217-1-AP) by Proteintech is a Polyclonal antibody targeting RPB5 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15217-1-AP targets RPB5 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  MCF-7 cells,  HepG2 cells,  rat liver tissue,  rat spleen tissue,  mouse spleen tissue,  mouse liver tissue,  Jurkat cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as \n\nsubstrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors \n\nand many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. polymerase (RNA) II is the \n\ncentral component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move \n\nrelative to each other. In Pol II, POLR2E (Polymerase (RNA) II (DNA directed) polypeptide E) \/RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process. The observed molecular weight of POLR2E is about 25 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7386 Product name: Recombinant human RNA Polymerase II protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC004441 Sequence: MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ Predict reactive species\nFull Name: polymerase (RNA) II (DNA directed) polypeptide E, 25kDa\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 23-25 kDa\nGenBank Accession Number: BC004441\nGene Symbol: RPB5\nGene ID (NCBI): 5434\nRRID: AB_2299932\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P19388\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869009334441,"sku":"15217-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15217-1-ap","provider":"Iright","version":"1.0","type":"link"}