{"product_id":"proteintech-15240-1-ap","title":"Proteintech, 15240-1-AP, HLA class I ABC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HLA class I ABC (15240-1-AP) by Proteintech is a Polyclonal antibody targeting HLA class I ABC in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n15240-1-AP targets HLA class I ABC in WB, IHC, IF\/ICC, IP, CoIP, RIP, ELISA, Cell treatment applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, NCI-H1299 cells,  Calu-1 cells,  HEK-293 cells,  HeLa cells,  HepG2 cells,  L02 cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human tonsillitis tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:5000-1:20000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). This class I molecules are polymorphic membrane glycoproteins composed of a heavy (alpha) chain (44 kDa) which is encoded by a HLA class I gene (HLA-A, B or C), and β2-microglobulin light (beta) chain (12 kDa). They are involved in the presentation of foreign antigens to the immune system. (PMID: 667938; 3375250)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7370 Product name: Recombinant human HLA class I (HLA-A) protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-302 aa of BC003069 Sequence: MRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSS Predict reactive species\nFull Name: major histocompatibility complex, class I, A\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 44 kDa\nGenBank Accession Number: BC003069\nGene Symbol: HLA-A\nGene ID (NCBI): 3105\nRRID: AB_1557426\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P04439\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868836548777,"sku":"15240-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15240-1-ap","provider":"Iright","version":"1.0","type":"link"}