{"product_id":"proteintech-15275-1-ap","title":"Proteintech, 15275-1-AP, VAPA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VAPA (15275-1-AP) by Proteintech is a Polyclonal antibody targeting VAPA in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15275-1-AP targets VAPA in WB, IHC, IF\/ICC, IP, COIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HEK-293 cells,  mouse skeletal muscle tissue,  human kidney tissue,  human brain tissue,  mouse kidney tissue,  mouse liver tissue,  rat liver tissue\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human colon cancer tissue, human liver cancer tissue,  mouse brain tissue,  mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVAPA (Vesicle-associated membrane protein-associated protein A), also known as VAP33, is a ubiquitously expressed integral membrane protein of the VAMP-associated protein (VAP) family. It is present in the plasma membrane and in intracellular vesicles, playing a role in vesicle trafficking.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7393 Product name: Recombinant human VAPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-221 aa of BC002992 Sequence: MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFR Predict reactive species\nFull Name: VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28-30 kDa\nGenBank Accession Number: BC002992\nGene Symbol: VAPA\nGene ID (NCBI): 9218\nRRID: AB_2256991\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P0L0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868858568873,"sku":"15275-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15275-1-ap","provider":"Iright","version":"1.0","type":"link"}