{"product_id":"proteintech-15277-1-ap","title":"Proteintech, 15277-1-AP, MRPS25 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRPS25 (15277-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS25 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15277-1-AP targets MRPS25 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitochondrial ribosomal protein S25 (MRPS25) belongs to the ribosomal protein S25\/L51 family. It is a component of the mitochondrial ribosome small subunit (28S). The variant segregated with the disease and substitutes a highly conserved proline residue with leucine (p.P72L) that, based on the high-resolution structure of the 28S ribosome, is predicted to compromise inter-protein contacts and destabilize the small subunit.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7395 Product name: Recombinant human MRPS25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-173 aa of BC003590 Sequence: MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD Predict reactive species\nFull Name: mitochondrial ribosomal protein S25\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC003590\nGene Symbol: MRPS25\nGene ID (NCBI): 64432\nRRID: AB_2180358\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P82663\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868970471593,"sku":"15277-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15277-1-ap","provider":"Iright","version":"1.0","type":"link"}