{"product_id":"proteintech-15299-1-ap","title":"Proteintech, 15299-1-AP, WWOX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WWOX (15299-1-AP) by Proteintech is a Polyclonal antibody targeting WWOX in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15299-1-AP targets WWOX in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, MCF-7 cells,  mouse skeletal muscle tissue,  mouse kidney tissue,  mouse liver tissue,  mouse testis tissue\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: human liver cancer tissue, mouse liver tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWWOX(WW domain-containing oxidoreductase) is also named as FOR, WOX1 and belongs to the short-chain dehydrogenases\/reductases (SDR) family. The gene encodes a 46 kDa protein that contains two WW domains and a short-chain dehydrogenase\/reductase domain and the protein is lost or reduced in the majority of many cancer types including breast, prostate, esophageal, lung, stomach, and pancreatic carcinomas and in a large fraction of other cancer types(PMID:17360458). WWOX behaves as a potential tumor-suppressor gene(PMID:15064722). It has 7 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7555 Product name: Recombinant human WWOX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-234 aa of BC003184 Sequence: MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG Predict reactive species\nFull Name: WW domain containing oxidoreductase\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC003184\nGene Symbol: WWOX\nGene ID (NCBI): 51741\nRRID: AB_2216389\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NZC7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868975648937,"sku":"15299-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15299-1-ap","provider":"Iright","version":"1.0","type":"link"}