{"product_id":"proteintech-15349-1-ap","title":"Proteintech, 15349-1-AP, CRIP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CRIP1 (15349-1-AP) by Proteintech is a Polyclonal antibody targeting CRIP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n15349-1-AP targets CRIP1 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  PC-3 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCRIP1 also known as CRIP, CRP1, belongs to the LIM\/double zinc finger protein family. CRIP1 has a unique double zinc finger motif, which is mainly expressed in the intestine, and may be involved in intestinal zinc transport (PMID: 31312368, 1946385). CRIP1 is overexpressed in immune cells of the epithelium and may play an important role in gut immunity(PMID: 27836662).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7588 Product name: Recombinant human CRIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC002738 Sequence: MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK Predict reactive species\nFull Name: cysteine-rich protein 1 (intestinal)\nCalculated Molecular Weight: 9 kDa\nObserved Molecular Weight: 8-9 kDa\nGenBank Accession Number: BC002738\nGene Symbol: CRIP1\nGene ID (NCBI): 1396\nRRID: AB_2878128\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P50238\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868996096169,"sku":"15349-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15349-1-ap","provider":"Iright","version":"1.0","type":"link"}