{"product_id":"proteintech-15357-1-ap","title":"Proteintech, 15357-1-AP, Cyclophilin E Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cyclophilin E (15357-1-AP) by Proteintech is a Polyclonal antibody targeting Cyclophilin E in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15357-1-AP targets Cyclophilin E in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, HeLa cells,  Jurkat cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclophilin E (CypE), also known as Cyclophilin-33, Rotamase E, CYP33, PPIE, is an enzyme which belongs to the cyclophilin-type PPIase family of PPIase E subfamily (PMID: 15998457). Cyclophilin E negatively regulates influenza virus replication and transcription occurs by impairing the formation of the vRNP (PMID: 21887220). Additionally, Cyclophilin E plays an important role in osteoblast differentiation as a positive regulator by increasing the transcriptional activity of Runx2 (PMID: 37947627).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7603 Product name: Recombinant human PPIE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC004898 Sequence: MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV Predict reactive species\nFull Name: peptidylprolyl isomerase E (cyclophilin E)\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 33-38 kDa\nGenBank Accession Number: BC004898\nGene Symbol: Cyclophilin E\nGene ID (NCBI): 10450\nRRID: AB_2878131\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UNP9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886998769833,"sku":"15357-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15357-1-ap","provider":"Iright","version":"1.0","type":"link"}