{"product_id":"proteintech-15380-1-ap","title":"Proteintech, 15380-1-AP, NDP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDP (15380-1-AP) by Proteintech is a Polyclonal antibody targeting NDP in WB, ELISA applications with reactivity to human,  mouse samples\n15380-1-AP targets NDP in WB, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, mouse eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDP, also named as EVR2, ND and Norrin, is a secreted regulatory protein that remains tightly associated with the extracellular matrix. Mutations in the NDP gene are associated with the Norrie disease. Signaling induced by the protein NDP regulates vascular development of vertebrate retina and controls important blood vessels in the ear. It binds with high affinity to Frizzled 4, and Frizzled 4 knockout mice exhibit abnormal vascular development of the retina. This antibody detects 11-15 kDa (monomer) and 48 kDa (polymers, refer: 25692504).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4066 Product name: Recombinant human NDP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-133 aa of BC029901 Sequence: MRKHVLAASFSMLSLLVIMGDTDSKTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS Predict reactive species\nFull Name: Norrie disease (pseudoglioma)\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 50-60 kDa\nGenBank Accession Number: BC029901\nGene Symbol: NDP\nGene ID (NCBI): 4693\nRRID: AB_2878133\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q00604\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887733821609,"sku":"15380-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15380-1-ap","provider":"Iright","version":"1.0","type":"link"}