{"product_id":"proteintech-15384-1-ap","title":"Proteintech, 15384-1-AP, CEL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CEL (15384-1-AP) by Proteintech is a Polyclonal antibody targeting CEL in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n15384-1-AP targets CEL in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human liver tissue,  HeLa cells,  mouse heart tissue,  mouse liver tissue\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human pancreas cancer tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBile salt-activated lipase, previously named cholesterol esterase or bile salt-stimulated (or dependent) lipase, is a 74 kDa lipolytic enzyme capable of hydrolyzing cholesteryl esters, tri-, di-, and mono-acylglycerols, phospholipids, lysophospholipids, and ceramide(PMID:12454261). The same enzyme is present as a major protein in milk and as a minor constituent in liver, activated macrophages, and endothelial cells(PMID:11733511). Defects in CEL are a cause of maturity-onset diabetes of the young type 8 with exocrine dysfunction (MODY8)(PMID:16369531). The full length protein has 11 glycosylation sites. It has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5262 Product name: Recombinant human CEL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 371-722 aa of BC042510 Sequence: SEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQDRTVSKAMIAYWTNFAKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSETAPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDAGPPPVPPTGDSGAPPVPPTGDSGAPPVTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIRF Predict reactive species\nFull Name: carboxyl ester lipase (bile salt-stimulated lipase)\nCalculated Molecular Weight: 79 kDa\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: BC042510\nGene Symbol: CEL\nGene ID (NCBI): 1056\nRRID: AB_2229297\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P19835\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868994425001,"sku":"15384-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15384-1-ap","provider":"Iright","version":"1.0","type":"link"}