{"product_id":"proteintech-15396-1-ap","title":"Proteintech, 15396-1-AP, MYL10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYL10 (15396-1-AP) by Proteintech is a Polyclonal antibody targeting MYL10 in WB, ELISA applications with reactivity to human, mouse, rat samples\n15396-1-AP targets MYL10 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse skeletal muscle tissue,  rat heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIn non-muscle cells, MLCs are either regulatory (RLC) or essential ELCs. The human RLC gene family encompasses MYL2, MYL5, MYL9, MYL10, MYL11, MYL12A, and MYL12B , with the ELC gene family including MYL1 , MYL3, MYL4, and MYL6(PMID: 39768172). MYL10, also known as PLRLC, encodes for an RLC that might be a lymphocyte specific precursor. MYL10 is a regulatory myosin light chain that is expressed in pre-B cells from adult bone marrow, but not those from fetal liver, upon exposure to IL-7(PMID: 1628631).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7594 Product name: Recombinant human MYL10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC002778 Sequence: MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD Predict reactive species\nFull Name: myosin, light chain 10, regulatory\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC002778\nGene Symbol: MYL10\nGene ID (NCBI): 93408\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BUA6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887730348201,"sku":"15396-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15396-1-ap","provider":"Iright","version":"1.0","type":"link"}