{"product_id":"proteintech-15449-1-ap","title":"Proteintech, 15449-1-AP, NSUN5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NSUN5 (15449-1-AP) by Proteintech is a Polyclonal antibody targeting NSUN5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15449-1-AP targets NSUN5 in WB, IHC, IF, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  human kidney tissue,  human placenta tissue\nPositive IHC detected in: mouse skeletal muscle tissue, human placenta tissue,  human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNSUN5 is a conserved RNA methyltransferase belonging to the Nop2\/SUN domain family, which is highly conserved from archaea to eukaryotes and has close contact with RNA methylation because of their S-adenosyl methionine binding-domain. NSUN5 was a promoter in the progression of CRC mainly through cell cycle regulation (PMID: 32774740). Loss of NSUN5 induces growth phenotypes in mice and different mammalian cells, which is likely connected to the requirement of NSUN5 for ribosomal RNA modification and normal global protein translation, especially in highly proliferative cells (PMID: 31722427). Western blot analysis detected NSUN5 at an apparent molecular mass of 47 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7711 Product name: Recombinant human NSUN5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 117-466 aa of BC008084 Sequence: RNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVEVPSSASQAKASAPERTPSPAPKRKKRQQRAAAGACTPPCT Predict reactive species\nFull Name: NOL1\/NOP2\/Sun domain family, member 5\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC008084\nGene Symbol: NSUN5\nGene ID (NCBI): 55695\nRRID: AB_2153808\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96P11\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868913488041,"sku":"15449-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15449-1-ap","provider":"Iright","version":"1.0","type":"link"}