{"product_id":"proteintech-15454-1-ap","title":"Proteintech, 15454-1-AP, S100A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe S100A2 (15454-1-AP) by Proteintech is a Polyclonal antibody targeting S100A2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n15454-1-AP targets S100A2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HaCaT cells, HeLa cells\nPositive IHC detected in: human bowen diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nS100A2 (S100 calcium-binding protein A2) is also named as S100L and CAN19. S100A2, a member of the S100 protein family, is more highly expressed in endometrial carcinoma tissues than in normal tissues and was correlated with worse survival (PMID: 35042454). S100A2 has a tumor suppressor function. S100A2 is highly upregulated in the epidermis under inflammatory conditions and in drug eruptions, in addition to inflammatory skin diseases such as atopic dermatitis and psoriasis (PMID: 35885660).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7719 Product name: Recombinant human S100A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC002829 Sequence: MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP Predict reactive species\nFull Name: S100 calcium binding protein A2\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC002829\nGene Symbol: S100A2\nGene ID (NCBI): 6273\nRRID: AB_3669209\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P29034\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869759754409,"sku":"15454-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15454-1-ap","provider":"Iright","version":"1.0","type":"link"}