{"product_id":"proteintech-15463-1-ap","title":"Proteintech, 15463-1-AP, SIN1\/MAPKAP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SIN1\/MAPKAP1 (15463-1-AP) by Proteintech is a Polyclonal antibody targeting SIN1\/MAPKAP1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15463-1-AP targets SIN1\/MAPKAP1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue,  HeLa cells\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: mouse kidney tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitogen-activated protein kinase 2-associated protein 1 (MAPKAP1) is also named as MIP1 and SIN1. SIN1\/MAPKAP1 is a major partner of mTORC2, acting as a scaffold and responsible for the substrate specificity of the mTOR catalytic subunit (PMID: 37877351). Besides as a component of MTORC2, MAPKAP1 also functions as MEKK2 and Ras-interacting protein and involves in regulating MEKK2 activation and RAS signaling (PMID: 31773361).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7753 Product name: Recombinant human MAPKAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-324 aa of BC002326 Sequence: MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSVDITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGSRAD Predict reactive species\nFull Name: mitogen-activated protein kinase associated protein 1\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC002326\nGene Symbol: MAPKAP1\nGene ID (NCBI): 79109\nRRID: AB_10598466\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BPZ7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868930068649,"sku":"15463-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15463-1-ap","provider":"Iright","version":"1.0","type":"link"}