{"product_id":"proteintech-15489-1-ap","title":"Proteintech, 15489-1-AP, CPSF6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CPSF6 (15489-1-AP) by Proteintech is a Polyclonal antibody targeting CPSF6 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n15489-1-AP targets CPSF6 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  Jurkat cells,  PC-3 cells,  MDA-MB-231 cells,  SW480 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human liver tissue, human heart tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SW480 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe binding of Cleavage factor Im (CFIM), also known as CPSF6, to the pre-mRNA is one of the earliest steps in the assembly of the cleavage and polyadenylation machinery and facilitates the recruitment of other processing factors. CFIM is required for the first step in pre-mRNA 3′-end processing and can be reconstituted in vitro from its heterologously expressed 25- and 68-kDa subunits. It involved in RNA binding, protein-protein interactions, and subcellular localization [PMID:15169763]. In addition, it is a pre-mRNA processing protein that dynamically shuttles between the nucleus and the cytoplasm and contains a C-terminal nuclear-targeting arginine\/serine-rich (RS-) domain of the type bound by TNPO3[PMID:15169763,19864460].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7852 Product name: Recombinant human CPSF6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC000714 Sequence: MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFEMQSRKTTQSGQMSGEGKAGPPGGSSRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGGPPPPFPGNLIKHLVKGTRPLFLETRIPWHMGHSIEEIPIFGLKAGQTPPRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQ Predict reactive species\nFull Name: cleavage and polyadenylation specific factor 6, 68kDa\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 55-68 kDa\nGenBank Accession Number: BC000714\nGene Symbol: CPSF6\nGene ID (NCBI): 11052\nRRID: AB_10694140\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16630\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868901363881,"sku":"15489-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15489-1-ap","provider":"Iright","version":"1.0","type":"link"}