{"product_id":"proteintech-15492-1-ap","title":"Proteintech, 15492-1-AP, MARK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MARK2 (15492-1-AP) by Proteintech is a Polyclonal antibody targeting MARK2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15492-1-AP targets MARK2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IP detected in: rat brain tissue\nPositive IHC detected in: human prostate cancer tissue, human brain tissue,  mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMARK2 is also named as EMK1(ELKL motif kinase 1), Par1b and belongs to the CAMK Ser\/Thr protein kinase family. Par1b\/MARK2 plays a critical role in neuronal polarity in the process of axon specification from multiple candidate neurites using primary cultures of mammalian hippocampal neurons(PMID:20194617). It has 16 isoforms produced by alternative promoter usage and alternative splicing with the molecular mass of 77-90kDa and can exsit as a dimer(PMID:16803889).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7884 Product name: Recombinant human MARK2 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-363 aa of BC008771 Sequence: LNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGYKSSELEGDTI Predict reactive species\nFull Name: MAP\/microtubule affinity-regulating kinase 2\nCalculated Molecular Weight: 88 kDa\nObserved Molecular Weight: 77-90 kDa\nGenBank Accession Number: BC008771\nGene Symbol: MARK2\nGene ID (NCBI): 2011\nRRID: AB_2140752\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7KZI7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868898119849,"sku":"15492-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15492-1-ap","provider":"Iright","version":"1.0","type":"link"}