{"product_id":"proteintech-15525-1-ap","title":"Proteintech, 15525-1-AP, SF3B5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SF3B5 (15525-1-AP) by Proteintech is a Polyclonal antibody targeting SF3B5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15525-1-AP targets SF3B5 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, HeLa cells,  mouse eye tissue\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Hela cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7205 Product name: Recombinant human SF3B5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC000198 Sequence: MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN Predict reactive species\nFull Name: splicing factor 3b, subunit 5, 10kDa\nCalculated Molecular Weight: 10 kDa\nObserved Molecular Weight: 10-12 kDa\nGenBank Accession Number: BC000198\nGene Symbol: SF3B5\nGene ID (NCBI): 83443\nRRID: AB_10596628\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BWJ5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887798210729,"sku":"15525-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15525-1-ap","provider":"Iright","version":"1.0","type":"link"}