{"product_id":"proteintech-15531-1-ap","title":"Proteintech, 15531-1-AP, HRAS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HRAS (15531-1-AP) by Proteintech is a Polyclonal antibody targeting HRAS in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15531-1-AP targets HRAS in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  PC-12 cells,  mouse kidney tissue,  rat kidney tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human stomach tissue, mouse intestineNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHRAS belongs to the small GTPase superfamily and Ras family. RAS family proteins (KRAS4A, KRAS4B, NRAS and HRAS) function as GDP-GTP-regulated binary on-off switches, which regulate cytoplasmic signaling networks that control diverse normal cellular processes (PMID: 26985062). HRAS is Involved in the activation of Ras protein signal transduction (PMID: 22821884). As HRAS mutations are associated to activation of RAF\/MEK\/ERK signaling in different cancers (PMID: 25435214). HRAS is mostly altered in head and neck squamous cell carcinoma (HNSCC) (5-9%), salivary glands (15%), and bladder cancer (5-30%) (PMID: 35621690).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7704 Product name: Recombinant human HRAS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC006499 Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGSRSGSSSSSGTLWDPPGPM Predict reactive species\nFull Name: v-Ha-ras Harvey rat sarcoma viral oncogene homolog\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC006499\nGene Symbol: HRAS\nGene ID (NCBI): 3265\nRRID: AB_2878147\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01112\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869465497769,"sku":"15531-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15531-1-ap","provider":"Iright","version":"1.0","type":"link"}