{"product_id":"proteintech-15549-1-ap","title":"Proteintech, 15549-1-AP, PRPS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRPS1 (15549-1-AP) by Proteintech is a Polyclonal antibody targeting PRPS1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15549-1-AP targets PRPS1 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, rat spleen tissue,  HeLa cells,  Jurkat cells,  mouse kidney tissue,  rat kidney tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRPS1, also named as Ribose-phosphate pyrophosphokinase 1, is a 318 amino acid protein, which belongs to the ribose-phosphate pyrophosphokinase family. PRPS1 can form Homodimer and the active form is probably a hexamer composed of 3 homodimers. PRPS1 catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) which is essential for nucleotide synthesis. PRPS1 as a module has an association with the Hepatocellular carcinoma.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7907 Product name: Recombinant human PRPS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-318 aa of BC001605 Sequence: MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL Predict reactive species\nFull Name: phosphoribosyl pyrophosphate synthetase 1\nCalculated Molecular Weight: 318 aa, 35 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC001605\nGene Symbol: PRPS1\nGene ID (NCBI): 5631\nRRID: AB_10694269\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P60891\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868891402409,"sku":"15549-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15549-1-ap","provider":"Iright","version":"1.0","type":"link"}