{"product_id":"proteintech-15557-1-ap","title":"Proteintech, 15557-1-AP, DIRAS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DIRAS2 (15557-1-AP) by Proteintech is a Polyclonal antibody targeting DIRAS2 in WB, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n15557-1-AP targets DIRAS2 in WB, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue, rat brain tissue,  HeLa cells,  mouse brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGTP-binding protein Di-Ras2 (DIRAS2) is a member of the Ras-related small G-protein family. DIRAS2 regulated the phosphorylation of downstream effector proteins and activated the RAS\/mitogen-activated protein kinase (MAPK) signaling pathway (PMID: 3216131). DIRAS2 interacted with 26S proteasome non-ATPase regulatory subunit 2, which facilitates the degradation of DIRAS2 in a proteasome-mediated way. DIRAS2 blocked nuclear factor kappa light-chain enhancer of activated B-cell (NF-κB) signaling pathways, inducing G0\/G1 arrest. DIRAS2 inhibited CRC cell proliferation and affected cell-cycle protein expression (PMID: 35173535). DIRAS2 was proved to be an oncogene that activated the RAS-MAPK pathway to induce cell proliferation and metastasis in renal cell cancer (PMID: 3216131). DIRAS2 also shows its activity as a tumor-suppressor gene to induce autophagic cell death via modulating nuclear localization FOXO3\/FOXO3A and TFEB (PMID: 29368982).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7926 Product name: Recombinant human DIRAS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC008065 Sequence: MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM Predict reactive species\nFull Name: DIRAS family, GTP-binding RAS-like 2\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC008065\nGene Symbol: DIRAS2\nGene ID (NCBI): 54769\nRRID: AB_2261563\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96HU8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868996718761,"sku":"15557-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15557-1-ap","provider":"Iright","version":"1.0","type":"link"}