{"product_id":"proteintech-15573-1-ap","title":"Proteintech, 15573-1-AP, NDUFC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFC2 (15573-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFC2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15573-1-AP targets NDUFC2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, human kidney tissue,  human liver tissue,  Hela cells,  HepG2 cells,  mouse brain tissue,  mouse heart tissue,  rat brain tissue\nPositive IHC detected in: human kidney tissue, human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7919 Product name: Recombinant human NDUFC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC007323 Sequence: MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC007323\nGene Symbol: NDUFC2\nGene ID (NCBI): 4718\nRRID: AB_10666733\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95298\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869418180777,"sku":"15573-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15573-1-ap","provider":"Iright","version":"1.0","type":"link"}