{"product_id":"proteintech-15576-1-ap","title":"Proteintech, 15576-1-AP, IDH3B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IDH3B (15576-1-AP) by Proteintech is a Polyclonal antibody targeting IDH3B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15576-1-AP targets IDH3B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HuH-7 cells,  Jurkat cells,  LNCaP cells,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIsocitrate dehydrogenase 3 (IDH3) is a key enzyme in the mitochondrial tricarboxylic acid (TCA) cycle, which catalyzes the decarboxylation of isocitrate into α-ketoglutarate and concurrently converts NAD+ into NADH. IDH3B(Isocitrate dehydrogenase 3 (NAD+) beta), also named as RP46, is the beta subunit of IDH3 and controls its substrate levels in the TCA cycle, and it is required for sperm mitochondrial metabolism and spermiogenesis (PMID: 18806796, PMID: 35985423). In addition, DH3B expression increased PFKFB3 protein levels and enhanced glucose uptake, and high expression of IDH3B correlated with poor survival in patients with ESCC, suggesting a potential application of IDH3B in prognosis (PMID: 31053633).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7965 Product name: Recombinant human IDH3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-385 aa of BC001960 Sequence: MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS Predict reactive species\nFull Name: isocitrate dehydrogenase 3 (NAD+) beta\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC001960\nGene Symbol: IDH3B\nGene ID (NCBI): 3420\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43837\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887675592873,"sku":"15576-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15576-1-ap","provider":"Iright","version":"1.0","type":"link"}