{"product_id":"proteintech-15581-1-ap","title":"Proteintech, 15581-1-AP, PCGF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCGF1 (15581-1-AP) by Proteintech is a Polyclonal antibody targeting PCGF1 in WB, ELISA applications with reactivity to human samples\n15581-1-AP targets PCGF1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPCGF1 (Polycomb group RING finger protein 1), also known as NSPC1. It is expected to be located in the nucleus. Human and mouse NSPc1 genes encode proteins with an N-terminal RING finger domain and share homology with Drosophila melanogaster lethal(3)73Ah and the mammalian Mel18 and Bmi1 genes. Transcripts are observed at 10 dpc in the otic vesicle, urogenital bud and dorsal root ganglia. At 11.5 dpc, transcripts are present in a subset of neural crest cell derivatives of the peripheral nervous system, and in the neural tube. NSPc1 expression is ubiquitous in adult tissue (PMID: 11287196). The molecular weight of PCGF1is 30 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7983 Product name: Recombinant human PCGF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-247 aa of BC004952 Sequence: MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR Predict reactive species\nFull Name: polycomb group ring finger 1\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 30-31 kDa\nGenBank Accession Number: BC004952\nGene Symbol: PCGF1\nGene ID (NCBI): 84759\nRRID: AB_3669212\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BSM1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887753220265,"sku":"15581-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15581-1-ap","provider":"Iright","version":"1.0","type":"link"}