{"product_id":"proteintech-15602-1-ap","title":"Proteintech, 15602-1-AP, NDFIP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDFIP1 (15602-1-AP) by Proteintech is a Polyclonal antibody targeting NDFIP1 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15602-1-AP targets NDFIP1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  SH-SY5Y cells\nPositive IP detected in: HEK-293 cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNdfip1 is an adaptor protein for the Nedd4 family of ubiquitin ligases and has been found to be upregulated in neurons after brain injury, including head trauma, stroke and metal toxicity. Recent studies confirmed the role of Ndfip1 as a regulator of iron metabolism and pointed out that Ndfip1 was involved in iron homeostasis by regulating the degradation of iron importer divalent metal transporter 1. Ndfip1 is a transmembrane protein that is localized to the Golgi and post-Golgi vesicles such as endosomes. It is an adaptor protein that recruits E3 ligases to ubiquitinate target proteins. It is ubiquitously expressed and contains 2 PY motifs, which interact with several Nedd4 family E3s to degradate proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7985 Product name: Recombinant human NDFIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC004317 Sequence: MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFM Predict reactive species\nFull Name: Nedd4 family interacting protein 1\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC004317\nGene Symbol: NDFIP1\nGene ID (NCBI): 80762\nRRID: AB_2878157\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BT67\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869418016937,"sku":"15602-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15602-1-ap","provider":"Iright","version":"1.0","type":"link"}