{"product_id":"proteintech-15655-1-ap","title":"Proteintech, 15655-1-AP, XPNPEP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe XPNPEP3 (15655-1-AP) by Proteintech is a Polyclonal antibody targeting XPNPEP3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15655-1-AP targets XPNPEP3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, human testis tissue,  human spleen tissue,  PC-3 cells,  4T1 cells,  mouse liver\nPositive IP detected in: PC-3 cells\nPositive IHC detected in: mouse liver tissue, human oesophagus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nXPNPEP3 gene encodes X-prolyl aminopeptidase 3 which functions to remove the penultimate N-terminal Proline residue from nascent proteins and appears to play a role in ciliary function. CRC tissue microarray revealed increased XPNPEP3 expression in tumor compared to matched normal samples (PMID:29383790). Other study found that XPNPEP3 localizes to mitochondria in renal cells in vitro and to kidney tubules in a cell type-specific pattern, and mutations in the gene are associated with NPHP-like disorder (PMID:20179356).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8007 Product name: Recombinant human XPNPEP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 158-507 aa of BC004989 Sequence: PSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQKLKDLGIMKNIKENNAFKAARKYCPHHVGHYLGMDVHDTPDMPRSLPLQPGMVITIEPGIYIPEDDKDAPEKFRGLGVRIEDDVVVTQDSPLILSADCPKEMNDIEQICSQAS Predict reactive species\nFull Name: X-prolyl aminopeptidase (aminopeptidase P) 3, putative\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC004989\nGene Symbol: XPNPEP3\nGene ID (NCBI): 63929\nRRID: AB_2288500\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQH7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887925186729,"sku":"15655-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15655-1-ap","provider":"Iright","version":"1.0","type":"link"}