{"product_id":"proteintech-15694-1-ap","title":"Proteintech, 15694-1-AP, CCNJ Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCNJ (15694-1-AP) by Proteintech is a Polyclonal antibody targeting CCNJ in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15694-1-AP targets CCNJ in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, rat kidney tissue\nPositive IHC detected in: rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCNJ (Cyclin-J) Belongs to the Cyclin family. Cyclin J is expressed in early Drosophila embryos, and it is essential for mediating intestinal epithelial cell recovery from bacterial pore-forming toxin attack in both Drosophila and mice. Upon TLR and IFN stimulation, cyclin J restrained macrophage inflammatory responses irrespective of the cell cycle control. Cyclin J interacted with CDKs and facilitated the phosphorylation of a set of CDK substrates, including FoxK1 and Drp1. Phosphorylation inhibited FoxK1-mediated expression of glycolytic genes by reducing FoxK1 nuclear localization. Cyclin J-CDK-dependent Drp1 phosphorylation also resulted in mitochondrial fission and the suppression of ROS production (PMID: 35412849).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8273 Product name: Recombinant human CCNJ protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-372 aa of BC043175 Sequence: MELEGQWWRGQLAADIHQALRYKELKLPSYKGQSPQLSLRRYFADLIAIVSNRFTLCPSARHLAVYLLDLFMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNLVLTKQNLLHMELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLEKTKLYMAKYADYFLEVSLQVAAACVASSRIILRLSPTWPTRLHRLTAYSWDFLVQCIERLLIAHDNDVKEANKQRGQAGPQSAQLSVFQTASQPSRPVHFQQPQYLHQTHQTSLQYRHPTSEQPSCQQIVSTTHTSSYTLQTCPAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLSVSYNRSYQINEHYPCITPCFER Predict reactive species\nFull Name: cyclin J\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC043175\nGene Symbol: CCNJ\nGene ID (NCBI): 54619\nRRID: AB_3085470\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5T5M9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886027002025,"sku":"15694-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15694-1-ap","provider":"Iright","version":"1.0","type":"link"}