{"product_id":"proteintech-15764-1-ap","title":"Proteintech, 15764-1-AP, MID1IP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MID1IP1 (15764-1-AP) by Proteintech is a Polyclonal antibody targeting MID1IP1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n15764-1-AP targets MID1IP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMID1IP1, also named as Mid1-interacting protein 1 or Gastrulation-specific G12-like protein, is a 183 amino acid protein, which belongs to the SPOT14 family. MID1IP1 plays a role in the regulation of lipogenesis in liver. MID1IP1 may localizes in the nucleus and cytoplasm. MID1IP1 may form  Homodimer in the absence of THRSP.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8400 Product name: Recombinant human MID1IP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC008908 Sequence: MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH Predict reactive species\nFull Name: MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish))\nCalculated Molecular Weight: 183 aa, 20 kDa\nObserved Molecular Weight: 23 kDa, 46 kDa\nGenBank Accession Number: BC008908\nGene Symbol: MID1IP1\nGene ID (NCBI): 58526\nRRID: AB_2878181\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NPA3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868957954217,"sku":"15764-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15764-1-ap","provider":"Iright","version":"1.0","type":"link"}