{"product_id":"proteintech-15791-1-ap","title":"Proteintech, 15791-1-AP, SMPX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMPX (15791-1-AP) by Proteintech is a Polyclonal antibody targeting SMPX in WB, IHC, ELISA applications with reactivity to human, pig samples\n15791-1-AP targets SMPX in WB, IHC, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig skeletal muscle tissue, human skeletal muscle tissue,  human colon tissue,  pig colon tissue\nPositive IHC detected in: human kidney tissue, human brain tissue,  human lung tissue,  human ovary tissue,  human spleen tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8497 Product name: Recombinant human SMPX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC005948 Sequence: MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ Predict reactive species\nFull Name: small muscle protein, X-linked\nCalculated Molecular Weight: 88 aa, 10 kDa\nObserved Molecular Weight: 9 kDa\nGenBank Accession Number: BC005948\nGene Symbol: SMPX\nGene ID (NCBI): 23676\nRRID: AB_2193527\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHP9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887810203817,"sku":"15791-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15791-1-ap","provider":"Iright","version":"1.0","type":"link"}