{"product_id":"proteintech-15805-1-ap","title":"Proteintech, 15805-1-AP, FXYD6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FXYD6 (15805-1-AP) by Proteintech is a Polyclonal antibody targeting FXYD6 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15805-1-AP targets FXYD6 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-12 cells, COLO 320 cells,  human brain tissue,  human testis tissue,  mouse brain tissue,  rat brain tissue,  SH-SY5Y cells\nPositive IHC detected in: rat brain tissue, human brain tissue,  human liver tissue,  human ovary tissue,  human skin tissue,  human spleen tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe FXYD family is a group of small single-span transmembrane proteins characterized by a signature sequence containing an FXYD motif, two conserved glycines and a serine residue. Members of the FXYD family, including FXYD1 (phospholemman), FXYD2 (gamma subunit of Na,K-ATPase), FXYD3 (Mat8), FXYD4 (CHIF), FXYD5 (RIC), FXYD6 (phosphohippolin) and FXYD7, are tissue specific regulators of the Na,K-ATPase. FXYD6 is primarily expressed in the brain. It modulates the kinetic activity of Na,K-ATPase and has long-term physiological importance in maintaining cation homeostasis. It may play a role in endolymph composition and has a potential important role in neuronal excitability of the CNS during postnatal development and in the adult brain. On the SDS-PAGE FXYD6 migrates with an apparent molecular weight of approximately 20 kDa, which is larger than the calculated molecular weight of 10.5 kDa (PMID: 15193427; 17209044). The gene encodes FXYD6 is located on chromosome 11q23.3, and it might be a susceptibility gene of schizophrenia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8538 Product name: Recombinant human FXYD6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-95 aa of BC018652 Sequence: KEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN Predict reactive species\nFull Name: FXYD domain containing ion transport regulator 6\nCalculated Molecular Weight: 95 aa, 11 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC018652\nGene Symbol: FXYD6\nGene ID (NCBI): 53826\nRRID: AB_2108625\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H0Q3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869407105193,"sku":"15805-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15805-1-ap","provider":"Iright","version":"1.0","type":"link"}