{"product_id":"proteintech-15843-1-ap","title":"Proteintech, 15843-1-AP, PLA2G1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLA2G1B (15843-1-AP) by Proteintech is a Polyclonal antibody targeting PLA2G1B in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n15843-1-AP targets PLA2G1B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue, mouse spleen tissue,  rat pancreas tissue,  pig pancreas tissue\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLA2G1B is a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. PLA2G1B catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8603 Product name: Recombinant human PLA2G1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC005386 Sequence: MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV Predict reactive species\nFull Name: phospholipase A2, group IB (pancreas)\nCalculated Molecular Weight: 70aa,8 kDa; 148aa,16 kDa\nObserved Molecular Weight: 13-16 kDa\nGenBank Accession Number: BC005386\nGene Symbol: PLA2G1B\nGene ID (NCBI): 5319\nRRID: AB_2878190\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P04054\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869486665897,"sku":"15843-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15843-1-ap","provider":"Iright","version":"1.0","type":"link"}