{"product_id":"proteintech-15857-1-ap","title":"Proteintech, 15857-1-AP, Histone H2B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Histone H2B (15857-1-AP) by Proteintech is a Polyclonal antibody targeting Histone H2B in WB, IHC, IF, IP, ELISA applications with reactivity to human, mouse, rat samples\n15857-1-AP targets Histone H2B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse pancreas tissue,  Jurkat cells,  rat kidney tissue,  HeLa cells,  U2OS cells,  mouse kidney tissue\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human prostate cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF detected in: N\/A\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF): IF : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHistone H2B is a core component of the nucleosome, the fundamental unit of chromatin. It forms a dimer with Histone H2A, and two H2A-H2B dimers combine with a (H3-H4)₂ tetramer to create the histone octamer. The primary function of this structure is to package DNA into a compact and manageable form. However, H2B is also subject to various post-translational modifications (PTMs), such as ubiquitination, which serve as epigenetic marks to regulate gene expression by altering chromatin accessibility.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7811 Product name: Recombinant human Histone H2B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-126 aa of BC005827 Sequence: MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK Predict reactive species\nFull Name: histone cluster 2, H2be\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 14-17 kDa\nGenBank Accession Number: BC005827\nGene Symbol: Histone H2B\nGene ID (NCBI): 8349\nRRID: AB_10664929\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16778\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868871512233,"sku":"15857-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15857-1-ap","provider":"Iright","version":"1.0","type":"link"}