{"product_id":"proteintech-15870-1-ap","title":"Proteintech, 15870-1-AP, SPANXE Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPANXE (15870-1-AP) by Proteintech is a Polyclonal antibody targeting SPANXE in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n15870-1-AP targets SPANXE in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells,  mouse skin tissue\nPositive IF\/ICC detected in: A375 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPANXE (Sperm protein associated with the nucleus on the X chromosome E), also known as SPANX A2 or SPANX C, is a member of the SPANX family. The SPANX genes encode \ndifferentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene encodes a sperm protein that contains a consensus \nnuclear localization signal but, although a role in spermatogenesis is suggested, the specific function of this family member has not yet been determined.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8572 Product name: Recombinant human SPANXE protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-97 aa of BC005382 Sequence: MDKQSSAGGVKRSVPCDSNEANEMMPETSSGYSDPQPAPKKLKTSESSTILVVRYRRNVKRTSPEELLNDHARENRINPLQMEEEEFMEIMVEIPAK Predict reactive species\nFull Name: SPANX family, member E\nCalculated Molecular Weight: 97 aa, 11 kDa\nObserved Molecular Weight: 15-20 kDa\nGenBank Accession Number: BC005382\nGene Symbol: SPANXE\nGene ID (NCBI): 171489\nRRID: AB_10951107\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TAD1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887813284009,"sku":"15870-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15870-1-ap","provider":"Iright","version":"1.0","type":"link"}