{"product_id":"proteintech-15875-1-ap","title":"Proteintech, 15875-1-AP, TNNC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TNNC2 (15875-1-AP) by Proteintech is a Polyclonal antibody targeting TNNC2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15875-1-AP targets TNNC2 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue,  rat skeletal muscle tissue\nPositive IHC detected in: human skeletal muscle tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8636 Product name: Recombinant human TNNC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC005323 Sequence: MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ Predict reactive species\nFull Name: troponin C type 2 (fast)\nCalculated Molecular Weight: 160 aa, 18 kDa\nObserved Molecular Weight: 20-23 kDa\nGenBank Accession Number: BC005323\nGene Symbol: TNNC2\nGene ID (NCBI): 7125\nRRID: AB_2878194\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P02585\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869620818089,"sku":"15875-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15875-1-ap","provider":"Iright","version":"1.0","type":"link"}