{"product_id":"proteintech-15881-1-ap","title":"Proteintech, 15881-1-AP, Sorbitol dehydrogenase Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Sorbitol dehydrogenase (15881-1-AP) by Proteintech is a Polyclonal antibody targeting Sorbitol dehydrogenase in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15881-1-AP targets Sorbitol dehydrogenase in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human kidney tissue,  rat liver tissue,  mouse liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSORD(Sorbitol dehydrogenase) is also named as L-iditol 2-dehydrogenase and belongs to the zinc-containing alcohol dehydrogenase family. It catalyzes the interconversion of polyols and their corresponding ketoses, and together with aldose reductase, makes up the sorbitol pathway that is believed to play an important role in the development of diabetic complications. This protein can form a homotetramer(PMID:12962626). Measurement of SORD is a specific indicator of liver cell damage and parenchymal.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8651 Product name: Recombinant human SORD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-357 aa of BC021085 Sequence: MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP Predict reactive species\nFull Name: sorbitol dehydrogenase\nCalculated Molecular Weight: 357 aa, 38 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC021085\nGene Symbol: SORD\nGene ID (NCBI): 6652\nRRID: AB_2192275\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q00796\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868960870569,"sku":"15881-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15881-1-ap","provider":"Iright","version":"1.0","type":"link"}